PDB entry 1eig

View 1eig on RCSB PDB site
Description: solution structure of the human chemokine eotaxin-2
Class: cytokine
Keywords: chemokine, chemotactic cytokine, eosinophil chemoattractant
Deposited on 2000-02-25, released 2000-12-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: eotaxin-2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00175 (0-72)
    • see remark 999 (46)
  Domains in SCOPe 2.08: d1eiga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eigA (A:)
  vvipspccmffvskripenrvvsyqlssrstclkagvifttkkgqqscgdpkqewvqrym
  knldakqkkaspr