PDB entry 1eie

View 1eie on RCSB PDB site
Description: crystal structure of f120w mutant of bovine pancreatic ribonuclease a
Deposited on 2000-02-25, released 2002-02-13
The last revision prior to the SCOP 1.61 freeze date was dated 2002-02-13, with a file datestamp of 2002-02-13.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.218
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1eiea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eieA (A:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhw
dasv