PDB entry 1eie

View 1eie on RCSB PDB site
Description: crystal structure of f120w mutant of bovine pancreatic ribonuclease a
Class: hydrolase
Keywords: ribonuclease, RNase A, Bovine pancreas, Hydrolase
Deposited on 2000-02-25, released 2002-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.218
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease a
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
    • engineered (119)
  Domains in SCOPe 2.08: d1eiea_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eieA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhw
  dasv