PDB entry 1eid

View 1eid on RCSB PDB site
Description: crystal structure of f120g mutant of bovine pancreatic ribonuclease a
Deposited on 2000-02-25, released 2002-02-13
The last revision prior to the SCOP 1.63 freeze date was dated 2002-02-13, with a file datestamp of 2002-02-13.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.21
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1eida_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eidA (A:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhg
dasv