PDB entry 1eib

View 1eib on RCSB PDB site
Description: crystal structure of chitinase a mutant d313a complexed with octa-n- acetylchitooctaose (nag)8.
Deposited on 2000-02-25, released 2001-02-25
The last revision prior to the SCOP 1.65 freeze date was dated 2001-09-26, with a file datestamp of 2001-09-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eibA (A:)
    aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
    keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvadtdgshlaplke
    plleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfipicggnginds
    lkeiegsfqalqrscqgredfkvsihdpfaalqkaqkgvtawddpykgnfgqlmalkqah
    pdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdiawefpggkgan
    pnlgspqdgetyvllmkelramldqlsvetgrkyeltsaisagkdkidkvaynvaqnsmd
    hiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgvkpgkivvgtam
    ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
    vfkpstgdlitfddarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq