PDB entry 1ei3

View 1ei3 on RCSB PDB site
Description: crystal structure of native chicken fibrinogen
Class: blood clotting
Keywords: coiled coils, disulfide rings, fibrin forming entities, BLOOD CLOTTING
Deposited on 2000-02-23, released 2000-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 5.5 Å
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrinogen
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ei3a_
  • Chain 'B':
    Compound: fibrinogen
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ei3b_
  • Chain 'C':
    Compound: fibrinogen
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ei3c_
  • Chain 'D':
    Compound: fibrinogen
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ei3d_
  • Chain 'E':
    Compound: fibrinogen
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ei3e_
  • Chain 'F':
    Compound: fibrinogen
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ei3f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ei3A (A:)
    qdgkttfekeggggrgprilenmhessckyeknwpicvdddwgtkcpsccrmqgiiddtd
    qnysqridnirqqladsqnkyktsnrvivetinilkpglegaqqldenyghvstelrrri
    vtlkqrvatqvnrikalqnsiqeqvvemkrlevdidikirackgscarsfdyqvdkegyd
    niqkhltqassidmhpdfqtttlstlkmrplkdsnvpehfklkpspemqamsafnnikqm
    qvvlerpetdhvaeargdsspshtgklitsshrrespslvdktssassvhrctrtvtkkv
    isgpdgpreeivekmvssdgsdcshlqggregstyhfsgtgdfhkldrllpdlesffthd
    svstssrhsigsstsshvtgagsshlgtggkdkftdlgeeeeddfgglqpsgfaagsash
    sktvltsssssfnkggstfetkslktretseqlggvqhdqsaedtpdfkarsfrpaamst
    rrsyngkgtqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ei3A (A:)
    picvdddwgtkcpsccrmqgiiddtdqnysqridnirqqladsqnkyktsnrvivetini
    lkpglegaqqldenyghvstelrrrivtlkqrvatqvnrikalqnsiqeqvvemkrlevd
    idikirackgscarsfdyqvdkegydniqkhltqassid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ei3B (B:)
    qasveydneedspqidarahrpldkrqeaaptlrpvappisgtgyqprppkqdkqamkkg
    piiypdaggckhpldelgvlcptgcelqttllkqektvkpvlrdlkdrvakfsdtsttmy
    qyvnmidnklvktqkqrkdndiilseyntemelhynyikdnldnnipsslrvlravidsl
    hkkiqklenaiatqtdycrspcvascnipvvsgrecediyrkggetsemyiiqpdpfttp
    yrvycdmetdnggwtliqnrqdgsvnfgrawdeykrgfgniaksggkkycdtpgeywlgn
    dkisqltkigptkvliemedwngdkvsalyggftihnegnkyqlsvsnykgnagnalmeg
    asqlygenrtmtihngmyfstydrdndgwlttdprkqcskedgggwwynrchaanpngry
    ywggtyswdmakhgtddgivwmnwkgswysmkkmsmkikpyfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ei3B (B:)
    ggckhpldelgvlcptgcelqttllkqektvkpvlrdlkdrvakfsdtsttmyqyvnmid
    nklvktqkqrkdndiilseyntemelhynyikdnldnnipsslrvlravidslhkkiqkl
    enaiatqtdycrspcvascnipvvsgrecediyrkggetsemyiiqpdpfttpyrvycdm
    etdnggwtliqnrqdgsvnfgrawdeykrgfgniaksggkkycdtpgeywlgndkisqlt
    kigptkvliemedwngdkvsalyggftihnegnkyqlsvsnykgnagnalmegasqlyge
    nrtmtihngmyfstydrdndgwlttdprkqcskedgggwwynrchaanpngryywggtys
    wdmakhgtddgivwmnwkgswysmkkmsmkikpyf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ei3C (C:)
    yiatrenccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyl
    iqhiktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnk
    itqlkqkiaqleshcqepckdtaeiqettgrdcqdiankgarksglyfikpqkakqsflv
    yceidtygngwtvlqrrldgsedfrrnwvqykegfghlspddttefwlgnekihlittqs
    tlpyalrieledwsgkkgtadyavfkvgteedkyrltyayfiggergdafdgfnfgddps
    dksytyhngmrfstfdndndnfegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgt
    nsydngiiwatwrdrwysmkkttmkiipfnrlsidgqqhsgglkqvgds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ei3C (C:)
    yiatrenccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyl
    iqhiktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnk
    itqlkqkiaqleshcqepckdtaeiqettgrdcqdiankgarksglyfikpqkakqsflv
    yceidtygngwtvlqrrldgsedfrrnwvqykegfghlspddttefwlgnekihlittqs
    tlpyalrieledwsgkkgtadyavfkvgteedkyrltyayfiggergdafdgfnfgddps
    dksytyhngmrfstfdndndnfegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgt
    nsydngiiwatwrdrwysmkkttmkiipfnrlsidgq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ei3D (D:)
    qdgkttfekeggggrgprilenmhessckyeknwpicvdddwgtkcpsccrmqgiiddtd
    qnysqridnirqqladsqnkyktsnrvivetinilkpglegaqqldenyghvstelrrri
    vtlkqrvatqvnrikalqnsiqeqvvemkrlevdidikirackgscarsfdyqvdkegyd
    niqkhltqassidmhpdfqtttlstlkmrplkdsnvpehfklkpspemqamsafnnikqm
    qvvlerpetdhvaeargdsspshtgklitsshrrespslvdktssassvhrctrtvtkkv
    isgpdgpreeivekmvssdgsdcshlqggregstyhfsgtgdfhkldrllpdlesffthd
    svstssrhsigsstsshvtgagsshlgtggkdkftdlgeeeeddfgglqpsgfaagsash
    sktvltsssssfnkggstfetkslktretseqlggvqhdqsaedtpdfkarsfrpaamst
    rrsyngkgtqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ei3D (D:)
    icvdddwgtkcpsccrmqgiiddtdqnysqridnirqqladsqnkyktsnrvivetinil
    kpglegaqqldenyghvstelrrrivtlkqrvatqvnrikalqnsiqeqvvemkrlevdi
    dikirackgscarsfdyqvdkegydniqkhltq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ei3E (E:)
    qasveydneedspqidarahrpldkrqeaaptlrpvappisgtgyqprppkqdkqamkkg
    piiypdaggckhpldelgvlcptgcelqttllkqektvkpvlrdlkdrvakfsdtsttmy
    qyvnmidnklvktqkqrkdndiilseyntemelhynyikdnldnnipsslrvlravidsl
    hkkiqklenaiatqtdycrspcvascnipvvsgrecediyrkggetsemyiiqpdpfttp
    yrvycdmetdnggwtliqnrqdgsvnfgrawdeykrgfgniaksggkkycdtpgeywlgn
    dkisqltkigptkvliemedwngdkvsalyggftihnegnkyqlsvsnykgnagnalmeg
    asqlygenrtmtihngmyfstydrdndgwlttdprkqcskedgggwwynrchaanpngry
    ywggtyswdmakhgtddgivwmnwkgswysmkkmsmkikpyfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ei3E (E:)
    ggckhpldelgvlcptgcelqttllkqektvkpvlrdlkdrvakfsdtsttmyqyvnmid
    nklvktqkqrkdndiilseyntemelhynyikdnldnnipsslrvlravidslhkkiqkl
    enaiatqtdycrspcvascnipvvsgrecediyrkggetsemyiiqpdpfttpyrvycdm
    etdnggwtliqnrqdgsvnfgrawdeykrgfgniaksggkkycdtpgeywlgndkisqlt
    kigptkvliemedwngdkvsalyggftihnegnkyqlsvsnykgnagnalmegasqlyge
    nrtmtihngmyfstydrdndgwlttdprkqcskedgggwwynrchaanpngryywggtys
    wdmakhgtddgivwmnwkgswysmkkmsmkikpyf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ei3F (F:)
    yiatrenccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyl
    iqhiktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnk
    itqlkqkiaqleshcqepckdtaeiqettgrdcqdiankgarksglyfikpqkakqsflv
    yceidtygngwtvlqrrldgsedfrrnwvqykegfghlspddttefwlgnekihlittqs
    tlpyalrieledwsgkkgtadyavfkvgteedkyrltyayfiggergdafdgfnfgddps
    dksytyhngmrfstfdndndnfegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgt
    nsydngiiwatwrdrwysmkkttmkiipfnrlsidgqqhsgglkqvgds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ei3F (F:)
    yiatrenccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyl
    iqhiktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnk
    itqlkqkiaqleshcqepckdtaeiqettgrdcqdiankgarksglyfikpqkakqsflv
    yceidtygngwtvlqrrldgsedfrrnwvqykegfghlspddttefwlgnekihlittqs
    tlpyalrieledwsgkkgtadyavfkvgteedkyrltyayfiggergdafdgfnfgddps
    dksytyhngmrfstfdndndnfegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgt
    nsydngiiwatwrdrwysmkkttmkiipfnrlsidgq