PDB entry 1ei0

View 1ei0 on RCSB PDB site
Description: nmr structure of the alpha-helical hairpin of p8mtcp1
Class: cell cycle
Keywords: helix-turn-helix, disulfide bridges, cell cycle
Deposited on 2000-02-23, released 2001-02-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p8mtcp1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56277 (0-37)
      • see remark 999 (7)
      • see remark 999 (19)
      • see remark 999 (31)
      • see remark 999 (34)
    Domains in SCOPe 2.08: d1ei0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ei0A (A:)
    dpcqkqaaeiqkclqansyleskcqaviqelkkcaaqy