PDB entry 1ehy

View 1ehy on RCSB PDB site
Description: X-ray structure of the epoxide hydrolase from agrobacterium radiobacter ad1
Class: hydrolase
Keywords: hydrolase, alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin
Deposited on 1998-10-17, released 1999-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (soluble epoxide hydrolase)
    Species: Agrobacterium tumefaciens [TaxId:358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31243 (Start-293)
      • cloning artifact (1)
    Domains in SCOPe 2.06: d1ehya1, d1ehya2
  • Chain 'B':
    Compound: protein (soluble epoxide hydrolase)
    Species: Agrobacterium tumefaciens [TaxId:358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31243 (Start-293)
      • cloning artifact (1)
    Domains in SCOPe 2.06: d1ehyb1, d1ehyb2
  • Chain 'C':
    Compound: protein (soluble epoxide hydrolase)
    Species: Agrobacterium tumefaciens [TaxId:358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31243 (Start-293)
      • cloning artifact (1)
    Domains in SCOPe 2.06: d1ehyc1, d1ehyc2
  • Chain 'D':
    Compound: protein (soluble epoxide hydrolase)
    Species: Agrobacterium tumefaciens [TaxId:358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31243 (Start-293)
      • cloning artifact (1)
    Domains in SCOPe 2.06: d1ehyd1, d1ehyd2
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ehyA (A:)
    mairrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydviv
    pdlrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirky
    sdrvikaaifdpiqpdfgpvyfglghvheswysqfhqldmavevvgssrevckkyfkhff
    dhwsyrdellteeelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtm
    iwglgdtcvpyapliefvpkyysnytmetiedcghflmvekpeiaidriktafr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehyA (A:)
    airrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydvivp
    dlrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirkys
    drvikaaifdpiqpdfeswysqfhqldmavevvgssrevckkyfkhffdhwsyrdellte
    eelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtmiwglgdtcvpya
    pliefvpkyysnytmetiedcghflmvekpeiaidriktafr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ehyB (B:)
    mairrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydviv
    pdlrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirky
    sdrvikaaifdpiqpdfgpvyfglghvheswysqfhqldmavevvgssrevckkyfkhff
    dhwsyrdellteeelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtm
    iwglgdtcvpyapliefvpkyysnytmetiedcghflmvekpeiaidriktafr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehyB (B:)
    airrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydvivp
    dlrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirkys
    drvikaaifdpiqpdfeswysqfhqldmavevvgssrevckkyfkhffdhwsyrdellte
    eelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtmiwglgdtcvpya
    pliefvpkyysnytmetiedcghflmvekpeiaidriktafr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ehyC (C:)
    mairrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydviv
    pdlrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirky
    sdrvikaaifdpiqpdfgpvyfglghvheswysqfhqldmavevvgssrevckkyfkhff
    dhwsyrdellteeelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtm
    iwglgdtcvpyapliefvpkyysnytmetiedcghflmvekpeiaidriktafr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehyC (C:)
    airrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydvivp
    dlrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirkys
    drvikaaifdpiqpdfeswysqfhqldmavevvgssrevckkyfkhffdhwsyrdellte
    eelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtmiwglgdtcvpya
    pliefvpkyysnytmetiedcghflmvekpeiaidriktafr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ehyD (D:)
    mairrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydviv
    pdlrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirky
    sdrvikaaifdpiqpdfgpvyfglghvheswysqfhqldmavevvgssrevckkyfkhff
    dhwsyrdellteeelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtm
    iwglgdtcvpyapliefvpkyysnytmetiedcghflmvekpeiaidriktafr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehyD (D:)
    airrpedfkhyevqlpdvkihyvregagptllllhgwpgfwwewskvigplaehydvivp
    dlrgfgdsekpdlndlskysldkaaddqaalldalgiekayvvghdfaaivlhkfirkys
    drvikaaifdpiqpdfeswysqfhqldmavevvgssrevckkyfkhffdhwsyrdellte
    eelevhvdncmkpdnihggfnyyranirpdaalwtdldhtmsdlpvtmiwglgdtcvpya
    pliefvpkyysnytmetiedcghflmvekpeiaidriktafr