PDB entry 1ehx

View 1ehx on RCSB PDB site
Description: nmr solution structure of the last unknown module of the cellulosomal scaffoldin protein cipc of clostridum cellulolyticum
Class: unknown function
Keywords: beta-beta-barrels, 3.10 helix, UNKNOWN FUNCTION
Deposited on 2000-02-23, released 2000-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: scaffoldin protein
  Species: Clostridium cellulolyticum [TaxId:1521]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q45996 (0-93)
    • conflict (0)
    • conflict (92-93)
  Domains in SCOPe 2.08: d1ehxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ehxA (A:)
  mqdptinptsisakagsfadtkitltpngntfngiselqssqytkgtnevtllasylntl
  penttktltfdfgvgtknpkltitvlpkdipgle