PDB entry 1ehs

View 1ehs on RCSB PDB site
Description: the structure of escherichia coli heat-stable enterotoxin b by nuclear magnetic resonance and circular dichroism
Class: enterotoxin
Keywords: heat-stable, enterotoxin, disulfide
Deposited on 1995-06-13, released 1995-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat-stable enterotoxin b
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ehsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ehsA (A:)
    stqsnkkdlcehyrqiakesckkgflgvrdgtagacfgaqimvaakgc