PDB entry 1ehl

View 1ehl on RCSB PDB site
Description: 64m-2 antibody fab complexed with d(5ht)(6-4)t
Class: immune system
Keywords: immunoglobulin, protein-DNA complex, DNA photoproduct, immune system
Deposited on 2000-02-21, released 2001-02-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.192
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-(d(5ht)p*(6-4)t)-3'
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: anti-(6-4) photoproduct antibody 64m-2 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EHL (0-218)
    Domains in SCOPe 2.03: d1ehlh1, d1ehlh2
  • Chain 'L':
    Compound: anti-(6-4) photoproduct antibody 64m-2 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EHL (0-216)
    Domains in SCOPe 2.03: d1ehll1, d1ehll2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ehlH (H:)
    evqlqqsgtvlarpgasvkmsckasgysftsfwmhwvkqrpgqglewigtiypgnsdtsy
    nqkfkgkakltavtsastaymevssltnedsavyyctrrsgykyyaldywgqgtsvtvss
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehlH (H:)
    evqlqqsgtvlarpgasvkmsckasgysftsfwmhwvkqrpgqglewigtiypgnsdtsy
    nqkfkgkakltavtsastaymevssltnedsavyyctrrsgykyyaldywgqgtsvtvss
    akttapsvyplapvcgdgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ehlL (L:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgslvptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne