PDB entry 1ehi

View 1ehi on RCSB PDB site
Description: d-alanine:d-lactate ligase (lmddl2) of vancomycin-resistant leuconostoc mesenteroides
Class: ligase
Keywords: ATP-binding. Grasp motif for ATP., LIGASE
Deposited on 2000-02-21, released 2000-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine:d-lactate ligase
    Species: Leuconostoc mesenteroides [TaxId:1245]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71454
      • conflict (269)
    Domains in SCOPe 2.07: d1ehia1, d1ehia2
  • Chain 'B':
    Compound: d-alanine:d-lactate ligase
    Species: Leuconostoc mesenteroides [TaxId:1245]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71454
      • conflict (269)
    Domains in SCOPe 2.07: d1ehib1, d1ehib2
  • Heterogens: MG, ADP, PHY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ehiA (A:)
    mtkkrvalifggnssehdvskrsaqnfynaieatgkyeiivfaiaqngffldtesskkil
    aledeqpivdafmktvdasdplarihalksagdfdiffpvvhgnlgedgtlqglfklldk
    pyvgaplrghavsfdkaltkelltvngirntkyivvdpesannwswdkivaelgnivfvk
    aanqgssvgisrvtnaeeytealsdsfqydykvlieeavngarelevgvigndqplvsei
    gahtvpnqgsgdgwydynnkfvdnsavhfqipaqlspevtkevkqmaldaykvlnlrgea
    rmdflldennvpylgepntlpgftnmslfkrlwdysdinnaklvdmlidygfedfaqnkk
    lsysfvslgeekigkfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehiA (A:)
    kkrvalifggnssehdvskrsaqnfynaieatgkyeiivfaiaqngffldtesskkilal
    edeqpivdafmktvdasdplarihalksagdfdiffpvvhgnlgedgtlqglfklldkpy
    vgaplrghavsfdkaltkelltvngirntkyivvdpesannwswdkivaelgnivfvkaa
    nqgssvgisrvtnaeeytealsdsfqydykvlieeavngarelevgvigndqplvseiga
    htvpnqgsgdgwydynnkfvdnsavhfqipaqlspevtkevkqmaldaykvlnlrgearm
    dflldennvpylgepntlpgftnmslfkrlwdysdinnaklvdmlidygfedfaqnkkls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ehiB (B:)
    mtkkrvalifggnssehdvskrsaqnfynaieatgkyeiivfaiaqngffldtesskkil
    aledeqpivdafmktvdasdplarihalksagdfdiffpvvhgnlgedgtlqglfklldk
    pyvgaplrghavsfdkaltkelltvngirntkyivvdpesannwswdkivaelgnivfvk
    aanqgssvgisrvtnaeeytealsdsfqydykvlieeavngarelevgvigndqplvsei
    gahtvpnqgsgdgwydynnkfvdnsavhfqipaqlspevtkevkqmaldaykvlnlrgea
    rmdflldennvpylgepntlpgftnmslfkrlwdysdinnaklvdmlidygfedfaqnkk
    lsysfvslgeekigkfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehiB (B:)
    tkkrvalifggnssehdvskrsaqnfynaieatgkyeiivfaiaqngffldtesskkila
    ledeqpivdafmktvdasdplarihalksagdfdiffpvvhgnlgedgtlqglfklldkp
    yvgaplrghavsfdkaltkelltvngirntkyivvdpesannwswdkivaelgnivfvka
    anqgssvgisrvtnaeeytealsdsfqydykvlieeavngarelevgvigndqplvseig
    ahtvhfqipaqlspevtkevkqmaldaykvlnlrgearmdflldennvpylgepntlpgf
    tnmslfkrlwdysdinnaklvdmlidygfedfaqnkklsysfvslge