PDB entry 1ehh
View 1ehh on RCSB PDB site
Description: crystal structure of urtica dioica agglutinin isolectin vi complex with tri-n-acetylchitotriose
Class: plant protein
Keywords: Two homologous hevein-like domains, PLANT PROTEIN
Deposited on
2000-02-21, released
2000-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-04, with a file datestamp of
2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: agglutinin isolectin vi
Species: Urtica dioica [TaxId:3501]
Database cross-references and differences (RAF-indexed):
- GB AAD05433 (0-88)
- modified residue (0)
- conflict (9)
- conflict (80)
Domains in SCOPe 2.07: d1ehha1, d1ehha2 - Chain 'B':
Compound: agglutinin isolectin vi
Species: Urtica dioica [TaxId:3501]
Database cross-references and differences (RAF-indexed):
- GB AAD05433 (0-88)
- modified residue (0)
- conflict (9)
- conflict (80)
Domains in SCOPe 2.07: d1ehhb1, d1ehhb2 - Heterogens: NAG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ehhA (A:)
ercgsqgggatcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
drccsvhgwcgggndycsggkcqyrcsss
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ehhB (B:)
ercgsqgggatcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
drccsvhgwcgggndycsggkcqyrcsss