PDB entry 1ehh

View 1ehh on RCSB PDB site
Description: crystal structure of urtica dioica agglutinin isolectin vi complex with tri-n-acetylchitotriose
Class: plant protein
Keywords: Two homologous hevein-like domains, PLANT PROTEIN
Deposited on 2000-02-21, released 2000-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agglutinin isolectin vi
    Species: Urtica dioica [TaxId:3501]
    Database cross-references and differences (RAF-indexed):
    • GB AAD05433 (0-88)
      • modified residue (0)
      • conflict (9)
      • conflict (80)
    Domains in SCOPe 2.07: d1ehha1, d1ehha2
  • Chain 'B':
    Compound: agglutinin isolectin vi
    Species: Urtica dioica [TaxId:3501]
    Database cross-references and differences (RAF-indexed):
    • GB AAD05433 (0-88)
      • modified residue (0)
      • conflict (9)
      • conflict (80)
    Domains in SCOPe 2.07: d1ehhb1, d1ehhb2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ehhA (A:)
    ercgsqgggatcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
    drccsvhgwcgggndycsggkcqyrcsss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ehhB (B:)
    ercgsqgggatcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
    drccsvhgwcgggndycsggkcqyrcsss