PDB entry 1ehg

View 1ehg on RCSB PDB site
Description: crystal structures of cytochrome p450nor and its mutants (ser286 val, thr) in the ferric resting state at cryogenic temperature: a comparative analysis with monooxygenase cytochrome p450s
Deposited on 2000-02-21, released 2000-08-21
The last revision prior to the SCOP 1.57 freeze date was dated 2000-11-29, with a file datestamp of 2000-11-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ehga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ehgA (A:)
    apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
    trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
    leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
    saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
    vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtavalaikrtakedvmigdkl
    vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
    vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif