PDB entry 1ehd

View 1ehd on RCSB PDB site
Description: crystal structure of urtica dioica agglutinin isolectin vi
Class: plant protein
Keywords: Two homologous hevein-like domains, PLANT PROTEIN
Deposited on 2000-02-20, released 2000-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.229
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: agglutinin isolectin vi
  Species: Urtica dioica [TaxId:3501]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9S7B3 (0-88)
    • modified residue (0)
    • conflict (9)
    • conflict (80)
  Domains in SCOPe 2.06: d1ehda1, d1ehda2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ehdA (A:)
  ercgsqgggatcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
  drccsvhgwcgggndycsggkcqyrcsss