PDB entry 1ehd

View 1ehd on RCSB PDB site
Description: crystal structure of urtica dioica agglutinin isolectin vi
Deposited on 2000-02-20, released 2000-04-05
The last revision prior to the SCOP 1.67 freeze date was dated 2000-04-05, with a file datestamp of 2000-04-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.229
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ehdA (A:)
    ercgsqgggatcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
    drccsvhgwcgggndycsggkcqyrcsss