PDB entry 1ehd

View 1ehd on RCSB PDB site
Description: crystal structure of urtica dioica agglutinin isolectin vi
Class: plant protein
Keywords: Two homologous hevein-like domains, PLANT PROTEIN
Deposited on 2000-02-20, released 2000-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agglutinin isolectin vi
    Species: Urtica dioica [TaxId:3501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S7B3 (0-88)
      • conflict (9)
      • conflict (80)
    Domains in SCOPe 2.08: d1ehda1, d1ehda2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ehdA (A:)
    ercgsqgggatcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
    drccsvhgwcgggndycsggkcqyrcsss