PDB entry 1ehc

View 1ehc on RCSB PDB site
Description: structure of signal transduction protein chey
Class: signal transduction
Keywords: chey, response regulators, chemotaxis, sensory transduction, phosphorylation, flagellar rot, signal transduction
Deposited on 1996-03-05, released 1997-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.143
AEROSPACI score: -1.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chey
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06143 (0-127)
    • engineered (11)
  Domains in SCOPe 2.08: d1ehca_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ehcA (A:)
  adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
  nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm