PDB entry 1ehb

View 1ehb on RCSB PDB site
Description: crystal structure of recombinant trypsin-solubilized fragment of cytochrome b5
Class: electron transport
Keywords: cytochrome b5; trypsin-cleaved fragment; recombinant wild type; crystal structure, electron transport
Deposited on 2000-02-20, released 2000-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (cytochrome b5)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00171 (0-81)
  Domains in SCOPe 2.08: d1ehba_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ehbA (A:)
  avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvg
  hstdarelsktfiigelhpddr