PDB entry 1eh6

View 1eh6 on RCSB PDB site
Description: human o6-alkylguanine-DNA alkyltransferase
Class: transferase
Keywords: alkyltransferase, methyltransferase, DNA repair
Deposited on 2000-02-18, released 2000-04-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: o6-alkylguanine-DNA alkyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eh6a1, d1eh6a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eh6A (A:)
    mdkdcemkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplm
    qctawlnayfhqpeaieefpvpalhhpvfqqesftrqvlwkllkvvkfgevisyqqlaal
    agnpkaaravggamrgnpvpilipchrvvcssgavgnysgglavkewllaheghrlgkpg
    lggssglagawlkgagatsgsppagrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eh6A (A:)
    cemkrttldsplgklelsgceqglheikllgevpapaavlggpeplmqctawlnayfhqp
    eaieefpvpalhhpvfqqesftrqvlwkllkvvkfgevisyqqlaalagnpkaaravgga
    mrgnpvpilipchrvvcssgavgnysgglavkewllaheghrlgkpgl