PDB entry 1eh4

View 1eh4 on RCSB PDB site
Description: binary complex of casein kinase-1 from s. pombe with an atp competitive inhibitor, ic261
Deposited on 2000-02-18, released 2001-09-19
The last revision prior to the SCOP 1.59 freeze date was dated 2001-09-19, with a file datestamp of 2001-09-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1eh4a_
  • Chain 'B':
    Domains in SCOP 1.59: d1eh4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eh4A (A:)
    nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
    tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
    slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
    sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
    cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eh4B (B:)
    nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
    tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
    slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
    sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
    cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll