PDB entry 1eh4

View 1eh4 on RCSB PDB site
Description: binary complex of casein kinase-1 from s. pombe with an ATP competitive inhibitor, ic261
Class: transferase
Keywords: protein kinase, casein kinase-1, protein-inhibitor binary complex, transferase
Deposited on 2000-02-18, released 2001-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase-1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eh4a_
  • Chain 'B':
    Compound: casein kinase-1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eh4b_
  • Heterogens: SO4, IC1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eh4A (A:)
    msgqnnvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtyk
    llagctgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvq
    sihekslvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsg
    tarymsinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqst
    plrelcagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eh4A (A:)
    nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
    tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
    slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
    sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
    cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eh4B (B:)
    msgqnnvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtyk
    llagctgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvq
    sihekslvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsg
    tarymsinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqst
    plrelcagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eh4B (B:)
    nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
    tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
    slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
    sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
    cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll