PDB entry 1eh3

View 1eh3 on RCSB PDB site
Description: r210k n-terminal lobe human lactoferrin
Class: metal transport
Keywords: iron transport, metal binding, metal transport
Deposited on 2000-02-18, released 2000-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactoferrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02788
      • see remark 999 (28)
      • see remark 999 (137)
      • engineered (210)
    Domains in SCOPe 2.07: d1eh3a_
  • Heterogens: FE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eh3A (A:)
    grrrrsvqwcavsqpeatkcfqwqrnmrrvrgppvscikrdspiqciqaiaenradavtl
    dggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtgl
    rrtagwnvpigtlrpfldwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgen
    kcafssqepyfsysgafkclrdgagdvafikestvfedlsdeaerdeyellcpdntrkpv
    dkfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdll
    fkdsaigfsrvppridsglylgsgyftaiqnlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eh3A (A:)
    rsvqwcavsqpeatkcfqwqrnmrrvrgppvscikrdspiqciqaiaenradavtldggf
    iyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglrrta
    gwnvpigtlrpfldwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenkcaf
    ssqepyfsysgafkclrdgagdvafikestvfedlsdeaerdeyellcpdntrkpvdkfk
    dchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllfkds
    aigfsrvppridsglylgsgyfta