PDB entry 1eh2

View 1eh2 on RCSB PDB site
Description: structure of the second eps15 homology domain of human eps15, nmr, 20 structures
Deposited on 1998-07-10, released 1999-07-22
The last revision prior to the SCOP 1.55 freeze date was dated 1999-07-22, with a file datestamp of 1999-07-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1eh2__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eh2_ (-)
  pwavkpedkakydaifdslspvngflsgdkvkpvllnsklpvdilgrvwelsdidhdgml
  drdefavamflvycalekepvpmslppalvppskr