PDB entry 1eh2

View 1eh2 on RCSB PDB site
Description: structure of the second eps15 homology domain of human eps15, nmr, 20 structures
Class: calcium binding
Keywords: calcium binding, signaling domain, npf binding, ef-hand, eh domain
Deposited on 1998-07-10, released 1999-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eps15
    Species: Homo sapiens [TaxId:9606]
    Gene: EPS15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eh2a_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1eh2A (A:)
nrwgspwavkpedkakydaifdslspvngflsgdkvkpvllnsklpvdilgrvwelsdid
hdgmldrdefavamflvycalekepvpmslppalvppskrktwlei

    Sequence, based on observed residues (ATOM records): (download) 
    >1eh2A (A:)
pwavkpedkakydaifdslspvngflsgdkvkpvllnsklpvdilgrvwelsdidhdgml
drdefavamflvycalekepvpmslppalvppskr