PDB entry 1eh0

View 1eh0 on RCSB PDB site
Description: cytochrome p450eryf with androstenedione bound
Class: oxidoreductase
Keywords: Cytochrome P450eryF eryF androstenedione steroid
Deposited on 2000-02-17, released 2000-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-04-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450eryf
    Species: Saccharopolyspora erythraea
    Database cross-references and differences (RAF-indexed):
    • GB 1310983 (0-402)
    Domains in SCOPe 2.07: d1eh0a_
  • Heterogens: HEM, ASD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eh0A (A:)
    atvpdlesdsfhvdwystyaelretapvtpvrflgqdawlvtgydeakaalsdlrlssdp
    kkkypgvevefpaylgfpedvrnyfatnmgtsdppthtrlrklvsqeftvrrveamrprv
    eqitaelldevgdsgvvdivdrfahplpikvicellgvdeaargafgrwsseilvmdper
    aeqrgqaarevvnfildlverrrtepgddllsalisvqddddgrlsadeltsialvllla
    gfeasvsligigtylllthpdqlalvradpsalpnaveeilryiappetttrfaaeevei
    ggvaipqystvlvangaanrdpsqfpdphrfdvtrdtrghlsfgqgihfcmgrplakleg
    evalralfgrfpalslgidaddvvwrrslllrgidhlpvrldg