PDB entry 1egz

View 1egz on RCSB PDB site
Description:
Deposited on 1999-03-18, released 1999-03-26
The last revision prior to the SCOP 1.63 freeze date was dated 1999-03-26, with a file datestamp of 1999-03-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1egza_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1egzb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1egzc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egzA (A:)
    sveplsvngnkiyagekaksfagnslfwsnngwggekfytadtvaslkkdwkssivraam
    gvqesggylqdpagnkakvervvdaaiandmyaiigwhshsaennrseairffqemarky
    gnkpnviyeiyneplqvswsntikpyaeavisairaidpdnliivgtpswsqnvdeasrd
    pinakniaytlhfyagthgeslrnkarqalnngialfvtewgtvnadgnggvnqtetdaw
    vtfmrdnnisnanwalndknegastyypdsknltesgkkvksiiqswpyka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egzB (B:)
    sveplsvngnkiyagekaksfagnslfwsnngwggekfytadtvaslkkdwkssivraam
    gvqesggylqdpagnkakvervvdaaiandmyaiigwhshsaennrseairffqemarky
    gnkpnviyeiyneplqvswsntikpyaeavisairaidpdnliivgtpswsqnvdeasrd
    pinakniaytlhfyagthgeslrnkarqalnngialfvtewgtvnadgnggvnqtetdaw
    vtfmrdnnisnanwalndknegastyypdsknltesgkkvksiiqswpyka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egzC (C:)
    sveplsvngnkiyagekaksfagnslfwsnngwggekfytadtvaslkkdwkssivraam
    gvqesggylqdpagnkakvervvdaaiandmyaiigwhshsaennrseairffqemarky
    gnkpnviyeiyneplqvswsntikpyaeavisairaidpdnliivgtpswsqnvdeasrd
    pinakniaytlhfyagthgeslrnkarqalnngialfvtewgtvnadgnggvnqtetdaw
    vtfmrdnnisnanwalndknegastyypdsknltesgkkvksiiqswpyka