PDB entry 1egz

View 1egz on RCSB PDB site
Description: cellulase cel5 from erwinia chrysanthemi, a family gh 5-2 enzyme
Class: hydrolase
Keywords: glycosyl hydrolase; clan gh-a; family 5-2; cellulase
Deposited on 1999-03-18, released 1999-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase z
    Species: Erwinia chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egza_
  • Chain 'B':
    Compound: endoglucanase z
    Species: Erwinia chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egzb_
  • Chain 'C':
    Compound: endoglucanase z
    Species: Erwinia chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egzc_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egzA (A:)
    sveplsvngnkiyagekaksfagnslfwsnngwggekfytadtvaslkkdwkssivraam
    gvqesggylqdpagnkakvervvdaaiandmyaiigwhshsaennrseairffqemarky
    gnkpnviyeiyneplqvswsntikpyaeavisairaidpdnliivgtpswsqnvdeasrd
    pinakniaytlhfyagthgeslrnkarqalnngialfvtewgtvnadgnggvnqtetdaw
    vtfmrdnnisnanwalndknegastyypdsknltesgkkvksiiqswpyka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egzB (B:)
    sveplsvngnkiyagekaksfagnslfwsnngwggekfytadtvaslkkdwkssivraam
    gvqesggylqdpagnkakvervvdaaiandmyaiigwhshsaennrseairffqemarky
    gnkpnviyeiyneplqvswsntikpyaeavisairaidpdnliivgtpswsqnvdeasrd
    pinakniaytlhfyagthgeslrnkarqalnngialfvtewgtvnadgnggvnqtetdaw
    vtfmrdnnisnanwalndknegastyypdsknltesgkkvksiiqswpyka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egzC (C:)
    sveplsvngnkiyagekaksfagnslfwsnngwggekfytadtvaslkkdwkssivraam
    gvqesggylqdpagnkakvervvdaaiandmyaiigwhshsaennrseairffqemarky
    gnkpnviyeiyneplqvswsntikpyaeavisairaidpdnliivgtpswsqnvdeasrd
    pinakniaytlhfyagthgeslrnkarqalnngialfvtewgtvnadgnggvnqtetdaw
    vtfmrdnnisnanwalndknegastyypdsknltesgkkvksiiqswpyka