PDB entry 1egy

View 1egy on RCSB PDB site
Description: cytochrome p450eryf with 9-aminophenanthrene bound
Class: oxidoreductase
Keywords: Cytochrome P450 Oxidoreductase Polycyclic aromatic hydrocarbon P450eryF
Deposited on 2000-02-17, released 2000-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.197
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450eryf
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egya_
  • Heterogens: HEM, 9AP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egyA (A:)
    atvpdlesdsfhvdwystyaelretapvtpvrflgqdawlvtgydeakaalsdlrlssdp
    kkkypgvevefpaylgfpedvrnyfatnmgtsdppthtrlrklvsqeftvrrveamrprv
    eqitaelldevgdsgvvdivdrfahplpikvicellgvdeaargafgrwsseilvmdper
    aeqrgqaarevvnfildlverrrtepgddllsalisvqddddgrlsadeltsialvllla
    gfeasvsligigtylllthpdqlalvradpsalpnaveeilryiappetttrfaaeevei
    ggvaipqystvlvangaanrdpsqfpdphrfdvtrdtrghlsfgqgihfcmgrplakleg
    evalralfgrfpalslgidaddvvwrrslllrgidhlpvrldg