PDB entry 1egx

View 1egx on RCSB PDB site
Description: solution structure of the ena-vasp homology 1 (evh1) domain of human vasodilator-stimulated phosphoprotein (vasp)
Class: signaling protein
Keywords: EVH1, VASP-Ena, NMR, POLY-PROLINE-BINDING DOMAIN
Deposited on 2000-02-17, released 2000-09-20
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vasodilator-stimulated phosphoprotein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1egxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egxA (A:)
    msetvicssratvmlyddgnkrwlpagtgpqafsrvqiyhnptansfrvvgrkmqpdqqv
    vincaivrgvkynqatpnfhqwrdarqvwglnfgskedaaqfaagmasalealeg