PDB entry 1egx

View 1egx on RCSB PDB site
Description: solution structure of the ena-vasp homology 1 (evh1) domain of human vasodilator-stimulated phosphoprotein (vasp)
Deposited on 2000-02-17, released 2000-09-20
The last revision prior to the SCOP 1.71 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1egxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1egxA (A:)
  msetvicssratvmlyddgnkrwlpagtgpqafsrvqiyhnptansfrvvgrkmqpdqqv
  vincaivrgvkynqatpnfhqwrdarqvwglnfgskedaaqfaagmasalealeg