PDB entry 1egx

View 1egx on RCSB PDB site
Description: solution structure of the ena-vasp homology 1 (evh1) domain of human vasodilator-stimulated phosphoprotein (vasp)
Class: signaling protein
Keywords: EVH1, VASP-Ena, POLY-PROLINE-BINDING DOMAIN, SIGNALING PROTEIN
Deposited on 2000-02-17, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vasodilator-stimulated phosphoprotein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egxA (A:)
    msetvicssratvmlyddgnkrwlpagtgpqafsrvqiyhnptansfrvvgrkmqpdqqv
    vincaivrgvkynqatpnfhqwrdarqvwglnfgskedaaqfaagmasalealeg