PDB entry 1egw

View 1egw on RCSB PDB site
Description: crystal structure of mef2a core bound to DNA
Class: transcription/DNA
Keywords: MADS-box transcription factor, DNA/protein complex, transcription/DNA
Deposited on 2000-02-17, released 2000-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.206
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mads box transcription enhancer factor 2, polypeptide a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egwa_
  • Chain 'B':
    Compound: mads box transcription enhancer factor 2, polypeptide a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egwb_
  • Chain 'C':
    Compound: mads box transcription enhancer factor 2, polypeptide a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egwc_
  • Chain 'D':
    Compound: mads box transcription enhancer factor 2, polypeptide a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egwd_
  • Chain 'E':
    Compound: DNA (5'-d(*ap*ap*ap*gp*cp*tp*ap*tp*tp*ap*tp*tp*ap*gp*cp*tp*t)-3')
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: DNA (5'-d(*tp*ap*ap*gp*cp*tp*ap*ap*tp*ap*ap*tp*ap*gp*cp*tp*t)-3')
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: DNA (5'-d(*tp*ap*ap*gp*cp*tp*ap*ap*tp*ap*ap*tp*ap*gp*cp*tp*t)-3')
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: DNA (5'-d(*ap*ap*ap*gp*cp*tp*ap*tp*tp*ap*tp*tp*ap*gp*cp*tp*t)-3')
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1egwA (A:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
    mdkvllkyteynephes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egwA (A:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
    mdkvllkytey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1egwB (B:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
    mdkvllkyteynephes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egwB (B:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
    mdkvllkyteyn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1egwC (C:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
    mdkvllkyteynephes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egwC (C:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
    mdkvllkyteyn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1egwD (D:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
    mdkvllkyteynephes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egwD (D:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
    mdkvllkytey
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.