PDB entry 1egu

View 1egu on RCSB PDB site
Description:
Deposited on 2000-02-16, released 2001-02-16
The last revision prior to the SCOP 1.59 freeze date was dated 2001-02-16, with a file datestamp of 2001-02-16.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.2
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eguA (A:)
    kdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekfs
    nyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivgn
    wwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggnl
    vdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgaygn
    vlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisranse
    ghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsll
    sdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwyts
    dgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddan
    atatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvy
    vndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegq
    sdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsvyda
    kqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevfkkl
    eqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eguA (A:)
    kdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekfs
    nyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivgn
    wwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggnl
    vdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgaygn
    vlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisranse
    ghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsll
    sdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwyts
    dgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddan
    atatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvy
    vndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegq
    sdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsvyda
    kqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevfkkq
    h