PDB entry 1egu

View 1egu on RCSB PDB site
Description: crystal structure of streptococcus pneumoniae hyaluronate lyase at 1.56 a resolution
Class: lyase
Keywords: (alfa5/alfa5) barrel, LYASE
Deposited on 2000-02-16, released 2001-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.2
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronate lyase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54873
      • see remark 999 (563)
      • expression tag (725)
    Domains in SCOPe 2.07: d1egua1, d1egua2, d1egua3, d1egua4
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eguA (A:)
    asvkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwe
    kfsnyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksi
    vgnwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalg
    gnlvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytga
    ygnvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisra
    nseghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmq
    sllsdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgw
    ytsdgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtskld
    danatatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpy
    kvyvndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdin
    egqsdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsv
    ydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevf
    kkleqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eguA (A:)
    kdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekfs
    nyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivgn
    wwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggnl
    vdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgaygn
    vlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisranse
    ghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsll
    sdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwyts
    dgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddan
    atatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvy
    vndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegq
    sdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsvyda
    kqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevfkkq
    h