PDB entry 1egr

View 1egr on RCSB PDB site
Description: sequence-specific 1h n.m.r. assignments and determination of the three-dimensional structure of reduced escherichia coli glutaredoxin
Class: electron transport
Keywords: electron transport
Deposited on 1991-10-08, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glutaredoxin
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68688 (0-84)
  Domains in SCOPe 2.04: d1egra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1egrA (A:)
  mqtvifgrsgcpycvrakdlaeklsnerddfqyqyvdiraegitkedlqqkagkpvetvp
  qifvdqqhiggytdfaawvkenlda