PDB entry 1egq

View 1egq on RCSB PDB site
Description: enhancement of enzyme activity through three-phase partitioning: crystal structure of a modified serine proteinase at 1.5 a resolution
Class: hydrolase
Keywords: Proteinase K, crystal structure, anhydrous organic solvents, stability, enhanced activity, HYDROLASE
Deposited on 2000-02-16, released 2001-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.197
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteinase K
    Species: Engyodontium album [TaxId:37998]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egqa_
  • Heterogens: CA, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egqA (A:)
    aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
    yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
    rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
    gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
    gkttaasacryiadtankgdlsnipfgtvnllaynnyqa