PDB entry 1egp
View 1egp on RCSB PDB site
Description: proteinase inhibitor eglin c with hydrolysed reactive center
Class: proteinase inhibitor
Keywords: proteinase inhibitor
Deposited on
1995-09-01, released
1995-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.122
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: eglin-c
Species: Hirudo medicinalis [TaxId:6421]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1egp.1 - Chain 'B':
Compound: eglin-c
Species: Hirudo medicinalis [TaxId:6421]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1egp.1 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1egpA (A:)
tefgselksfpevvgktvdqareyftlhypqynvyflpegspvtl
Sequence, based on observed residues (ATOM records): (download)
>1egpA (A:)
lksfpevvgktvdqareyftlhypqynvyflpegspvtl
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1egpB (B:)
dlrynrvrvfynpgtnvvnhvphvg
Sequence, based on observed residues (ATOM records): (download)
>1egpB (B:)
ynrvrvfynpgtnvvnhvphvg