PDB entry 1egp

View 1egp on RCSB PDB site
Description: proteinase inhibitor eglin c with hydrolysed reactive center
Class: proteinase inhibitor
Keywords: proteinase inhibitor
Deposited on 1995-09-01, released 1995-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.122
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eglin-c
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01051 (Start-44)
      • conflict (32)
    Domains in SCOPe 2.08: d1egp.1
  • Chain 'B':
    Compound: eglin-c
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1egp.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1egpA (A:)
    tefgselksfpevvgktvdqareyftlhypqynvyflpegspvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egpA (A:)
    lksfpevvgktvdqareyftlhypqynvyflpegspvtl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1egpB (B:)
    dlrynrvrvfynpgtnvvnhvphvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egpB (B:)
    ynrvrvfynpgtnvvnhvphvg