PDB entry 1ego

View 1ego on RCSB PDB site
Description: nmr structure of oxidized escherichia coli glutaredoxin: comparison with reduced e. coli glutaredoxin and functionally related proteins
Deposited on 1991-10-08, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ego__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ego_ (-)
    mqtvifgrsgcpycvrakdlaeklsnerddfqyqyvdiraegitkedlqqkagkpvetvp
    qifvdqqhiggytdfaawvkenlda