PDB entry 1egn

View 1egn on RCSB PDB site
Description: cellobiohydrolase cel7a (e223s, a224h, l225v, t226a, d262g) mutant
Class: hydrolase
Keywords: hydrolase, glycosidase, cellulase, cellulose degradation, glycoprotein, glycosylated protein, ph-mutant
Deposited on 2000-02-16, released 2001-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.24
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-beta-d-glucan cellobiohydrolase cel7a
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62694 (0-433)
      • modified residue (0)
      • see remark 999 (93)
      • engineered (222-225)
      • engineered (261)
    Domains in SCOPe 2.07: d1egna_
  • Heterogens: NAG, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egnA (A:)
    esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
    cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
    tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
    kfingqanvegwepssnnantgigghgsccsemdiweansisshvaphpcttvgqeiceg
    dgcggtysdnryggtcdpdgcgwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
    nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
    vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
    ikfgpigstgnpsg