PDB entry 1egm

View 1egm on RCSB PDB site
Description: crystal structure of diol dehydratase-cyanocobalamin complex at 100k.
Deposited on 2000-02-15, released 2000-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.249
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1egma_
  • Chain 'B':
    Domains in SCOP 1.55: d1egmb_
  • Chain 'E':
    Domains in SCOP 1.55: d1egme_
  • Chain 'G':
    Domains in SCOP 1.55: d1egmg_
  • Chain 'L':
    Domains in SCOP 1.55: d1egml_
  • Chain 'M':
    Domains in SCOP 1.55: d1egmm_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egmA (A:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egmB (B:)
    gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
    rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
    rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egmE (E:)
    gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
    rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
    rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egmG (G:)
    sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
    grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
    reaatlyverkklkgdd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egmL (L:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpn
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egmM (M:)
    sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
    grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
    reaatlyverkklkgdd