PDB entry 1egj

View 1egj on RCSB PDB site
Description: domain 4 of the beta common chain in complex with an antibody
Class: immune system
Keywords: cytokine receptor complexed to an antibody, IMMUNE SYSTEM
Deposited on 2000-02-15, released 2001-02-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.228
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytokine receptor common beta chain precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1egja_
  • Chain 'H':
    Compound: antibody (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01865 (0-219)
      • conflict (38)
      • conflict (110)
      • conflict (113)
      • conflict (118)
      • conflict (123)
      • conflict (132-136)
      • conflict (138)
      • conflict (140)
      • conflict (157)
      • conflict (189)
      • conflict (196-198)
      • conflict (218-219)
    Domains in SCOPe 2.03: d1egjh1, d1egjh2
  • Chain 'L':
    Compound: antibody (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAB75889 (0-214)
      • conflict (83)
      • conflict (112)
      • conflict (147)
      • conflict (150)
    Domains in SCOPe 2.03: d1egjl1, d1egjl2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egjA (A:)
    iqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahsm
    alpalepstrywarvrvrtsrtgyngiwsewsearswdtes
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egjH (H:)
    evqlqqsgpelvkpgtsvkmsckasgytftdyymkwvkhshgkslewigdinpsnggtly
    nqkfkgkatltvdkssstasmqlsrltsedsavyycsrgdgihggfaywgqgttvtvssa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkivpqv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egjL (L:)
    nivltqspaslavslgqratiscranesvysygdsfmhwyqqkpgqppklliylasnlas
    gvparfsgsgsrtdftltidpvetddaatyycqqnnedpwtfgggtkleikrgdaaptvs
    ifppsseqltsggasvvcflnnfypkdanvawkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr