PDB entry 1egg

View 1egg on RCSB PDB site
Description: structure of a c-type carbohydrate-recognition domain (crd-4) from the macrophage mannose receptor
Class: sugar binding protein
Keywords: C-type lectin, mannose receptor, SUGAR BINDING PROTEIN
Deposited on 2000-02-15, released 2000-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage mannose receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1egga_
  • Chain 'B':
    Compound: macrophage mannose receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eggb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eggA (A:)
    gipkcpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwr
    litasgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdpt
    mswndincehlnnwicqiqkgqtpkpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eggA (A:)
    cpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlita
    sgsyhklfwlgltyggftwsdgspvsyenwaygepnnyqnveycgelkgdptmswndinc
    ehlnnwicqiqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eggB (B:)
    gipkcpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwr
    litasgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdpt
    mswndincehlnnwicqiqkgqtpkpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eggB (B:)
    ipkcpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrl
    itasgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptm
    swndincehlnnwicqiqkgqtpk