PDB entry 1egf

View 1egf on RCSB PDB site
Description: solution structure of murine epidermal growth factor determined by nmr spectroscopy and refined by energy minimization with restraints
Deposited on 1991-10-01, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1egf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egf_ (-)
    nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr