PDB entry 1ege

View 1ege on RCSB PDB site
Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase
Class: electron transfer
Keywords: acyl-coa dehydrogenase, flavoprotein, electron transfer
Deposited on 1996-04-11, released 1997-06-16
The last revision prior to the SCOP 1.73 freeze date was dated 1997-06-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.221
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: medium chain acyl-coa dehydrogenase
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1egea1, d1egea2
  • Chain 'B':
    Compound: medium chain acyl-coa dehydrogenase
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1egeb1, d1egeb2
  • Chain 'C':
    Compound: medium chain acyl-coa dehydrogenase
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1egec1, d1egec2
  • Chain 'D':
    Compound: medium chain acyl-coa dehydrogenase
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1eged1, d1eged2
  • Heterogens: FAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1egeA (A:)
    kanrqrepglgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelg
    lmnthipencgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvlig
    dgagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlae
    mamkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfntey
    pveklmrdakiyqiyegtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egeA (A:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkykn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1egeB (B:)
    kanrqrepglgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelg
    lmnthipencgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvlig
    dgagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlae
    mamkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfntey
    pveklmrdakiyqiyegtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egeB (B:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkykn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1egeC (C:)
    kanrqrepglgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelg
    lmnthipencgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvlig
    dgagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlae
    mamkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfntey
    pveklmrdakiyqiyegtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egeC (C:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkykn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1egeD (D:)
    kanrqrepglgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelg
    lmnthipencgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvlig
    dgagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlae
    mamkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfntey
    pveklmrdakiyqiyegtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egeD (D:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkykn