PDB entry 1egc

View 1egc on RCSB PDB site
Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase complexed with octanoyl-coa
Class: electron transfer
Keywords: acyl-coa dehydrogenase, flavoprotein, electron transfer
Deposited on 1996-04-11, released 1997-11-12
The last revision prior to the SCOP 1.73 freeze date was dated 1997-11-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: medium chain acyl-coa dehydrogenase
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11310 (Start-395)
      • engineered (254)
      • engineered (375)
    Domains in SCOP 1.73: d1egca1, d1egca2
  • Chain 'B':
    Compound: medium chain acyl-coa dehydrogenase
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11310 (Start-395)
      • engineered (254)
      • engineered (375)
    Domains in SCOP 1.73: d1egcb1, d1egcb2
  • Chain 'C':
    Compound: medium chain acyl-coa dehydrogenase
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11310 (Start-395)
      • engineered (254)
      • engineered (375)
    Domains in SCOP 1.73: d1egcc1, d1egcc2
  • Chain 'D':
    Compound: medium chain acyl-coa dehydrogenase
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11310 (Start-395)
      • engineered (254)
      • engineered (375)
    Domains in SCOP 1.73: d1egcd1, d1egcd2
  • Heterogens: CO8, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1egcA (A:)
    kanrqrepglgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelg
    lmnthipencgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvlig
    dgagfkvamgafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlae
    mamkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfntey
    pveklmrdakiyqiyggtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egcA (A:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyggtsqiqrlivarehidkykn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1egcB (B:)
    kanrqrepglgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelg
    lmnthipencgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvlig
    dgagfkvamgafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlae
    mamkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfntey
    pveklmrdakiyqiyggtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egcB (B:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyggtsqiqrlivarehidkykn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1egcC (C:)
    kanrqrepglgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelg
    lmnthipencgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvlig
    dgagfkvamgafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlae
    mamkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfntey
    pveklmrdakiyqiyggtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egcC (C:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyggtsqiqrlivarehidkykn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1egcD (D:)
    kanrqrepglgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelg
    lmnthipencgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvlig
    dgagfkvamgafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlae
    mamkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfntey
    pveklmrdakiyqiyggtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egcD (D:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyggtsqiqrlivarehidkykn