PDB entry 1ega

View 1ega on RCSB PDB site
Description: crystal structure of a widely conserved gtpase era
Class: hydrolase
Keywords: era, gtpase, RNA-binding, ras-like, hydrolase
Deposited on 1998-12-01, released 1999-07-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.243
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (GTP-binding protein era)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1egaa1, d1egaa2
  • Chain 'B':
    Compound: protein (GTP-binding protein era)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1egab1, d1egab2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1egaA (A:)
    msidksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiy
    vdtpglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvi
    lavnkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhf
    pedyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilvere
    gqkkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslgyvdd
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egaA (A:)
    dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
    pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
    nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfped
    yitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregqk
    kmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1egaB (B:)
    msidksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiy
    vdtpglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvi
    lavnkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhf
    pedyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilvere
    gqkkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslgyvdd
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egaB (B:)
    dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
    pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
    nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfped
    yitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregqk
    kmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslg