PDB entry 1eg7

View 1eg7 on RCSB PDB site
Description: the crystal structure of formyltetrahydrofolate synthetase from moorella thermoacetica
Class: ligase
Keywords: Synthetase, Folate Binding, ATP Binding, Formate Binding, Monovalent Cation Binding, LIGASE
Deposited on 2000-02-14, released 2001-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.253
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formyltetrahydrofolate synthetase
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21164
      • conflict (173)
      • conflict (224)
    Domains in SCOPe 2.07: d1eg7a_
  • Chain 'B':
    Compound: formyltetrahydrofolate synthetase
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21164
      • conflict (173)
      • conflict (224)
    Domains in SCOPe 2.07: d1eg7b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eg7A (A:)
    mskvpsdieiaqaakmkpvmelarglgiqedevelygkykakisldvyrrlkdkpdgkli
    lvtaitptpagegktttsvgltdalarlgkrvmvclrepslgpsfgikggaagggyaqvv
    pmedinlhftgdihavtyahnllaamvdnhlqqgnvlnidprtitwrrvidlneralrni
    viglggkangvpretgfdisvasevmaclclasdlmdlkerfsrkvvgytydgkpvtagd
    leaqgsmallmkdaikpnlvqtlentpafihggpfaniahgcnsiiatktalkladyvvt
    eagfgadlgaekfydvkcryagfkpdatvivatvralkmhggvpksdlatenlealregf
    anlekhienigkfgvpavvainafptdteaelnllyelcakagaevalswakggegglel
    arkvlqtlesrpsnfhvlynldlsikdkiakiateiygadgvnytaeadkaiqryeslgy
    gnlpvvmaktqysfsddmtklgrprnftitvrevrlsaggrlivpitgaimtmpglpkrp
    aacnididadgvitglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg7A (A:)
    dieiaqaakmkpvmelarglgiqedevelygkykakisldvyrrlkdkpdgklilvtait
    ptpagegktttsvgltdalarlgkrvmvclrepslgpsfgikggaagggyaqvvpmedin
    lhftgdihavtyahnllaamvdnhlqqgnvlnidprtitwrrvidlneralrniviglgg
    kangvpretgfdisvasevmaclclasdlmdlkerfsrkvvgytydgkpvtagdleaqgs
    mallmkdaikpnlvqtlentpafihggpfaniahgcnsiiatktalkladyvvteagfga
    dlgaekfydvkcryagfkpdatvivatvralkmhggvpksdlatenlealregfanlekh
    ienigkfgvpavvainafptdteaelnllyelcakagaevalswakggegglelarkvlq
    tlesrpsnfhvlynldlsikdkiakiateiygadgvnytaeadkaiqryeslgygnlpvv
    maktqysfsddmtklgrprnftitvrevrlsaggrlivpitgaimtmpglpkrpaacnid
    idadgvitg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eg7B (B:)
    mskvpsdieiaqaakmkpvmelarglgiqedevelygkykakisldvyrrlkdkpdgkli
    lvtaitptpagegktttsvgltdalarlgkrvmvclrepslgpsfgikggaagggyaqvv
    pmedinlhftgdihavtyahnllaamvdnhlqqgnvlnidprtitwrrvidlneralrni
    viglggkangvpretgfdisvasevmaclclasdlmdlkerfsrkvvgytydgkpvtagd
    leaqgsmallmkdaikpnlvqtlentpafihggpfaniahgcnsiiatktalkladyvvt
    eagfgadlgaekfydvkcryagfkpdatvivatvralkmhggvpksdlatenlealregf
    anlekhienigkfgvpavvainafptdteaelnllyelcakagaevalswakggegglel
    arkvlqtlesrpsnfhvlynldlsikdkiakiateiygadgvnytaeadkaiqryeslgy
    gnlpvvmaktqysfsddmtklgrprnftitvrevrlsaggrlivpitgaimtmpglpkrp
    aacnididadgvitglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg7B (B:)
    ieiaqaakmkpvmelarglgiqedevelygkykakisldvyrrlkdkpdgklilvtaitp
    tpagegktttsvgltdalarlgkrvmvclrepslgpsfgikggaagggyaqvvpmedinl
    hftgdihavtyahnllaamvdnhlqqgnvlnidprtitwrrvidlneralrniviglggk
    angvpretgfdisvasevmaclclasdlmdlkerfsrkvvgytydgkpvtagdleaqgsm
    allmkdaikpnlvqtlentpafihggpfaniahgcnsiiatktalkladyvvteagfgad
    lgaekfydvkcryagfkpdatvivatvralkmhggvpksdlatenlealregfanlekhi
    enigkfgvpavvainafptdteaelnllyelcakagaevalswakggegglelarkvlqt
    lesrpsnfhvlynldlsikdkiakiateiygadgvnytaeadkaiqryeslgygnlpvvm
    aktqysfsddmtklgrprnftitvrevrlsaggrlivpitgaimtmpglpkrpaacnidi
    dadgvitg