PDB entry 1eg4

View 1eg4 on RCSB PDB site
Description: structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
Class: structural protein
Keywords: EF-hand like domain, WW domain, Polyproline type II (PPII) helix, STRUCTURAL PROTEIN
Deposited on 2000-02-11, released 2000-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dystrophin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eg4a1, d1eg4a2, d1eg4a3
  • Chain 'P':
    Compound: beta-dystroglycan
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eg4A (A:)
    gpasqhflstsvqgpweraispnkvpyyinhetqttcwdhpkmtelyqsladlnnvrfsa
    yrtamklrrlqkalcldllslsaacdaldqhnlkqndqpmdilqiinclttiydrleqeh
    nnlvnvplcvdmclnwllnvydtgrtgrirvlsfktgiislckahledkyrylfkqvass
    tgfcdqrrlglllhdsiqiprqlgevasfggsniepsvrscfqfannkpeieaalfldwm
    rlepqsmvwlpvlhrvaaaet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg4A (A:)
    pasqhflstsvqgpweraispnkvpyyinhetqttcwdhpkmtelyqsladlnnvrfsay
    rtamklrrlqkalcldllslsaacdaldqhnlkqndqpmdilqiinclttiydrleqehn
    nlvnvplcvdmclnwllnvydtgrtgrirvlsfktgiislckahledkyrylfkqvasst
    gfcdqrrlglllhdsiqiprqlgevasfggsniepsvrscfqfannkpeieaalfldwmr
    lepqsmvwlpvlhrvaaaet
    

  • Chain 'P':
    No sequence available.